Recombinant Human VEGFC protein, His-tagged
Cat.No. : | VEGFC-533H |
Product Overview : | Recombinant Human VEGFC protein(P49767)(32-419aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 32-419aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCPTNYMWNNHICRCLAQEDFMFSSDAGDDSTDGFHDICGPNKELDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTESPQKCLLKGKKFHHQTCSCYRRPCTNRQKACEPGFSYSEEVCRCVPSYWKRPQMS |
Gene Name | VEGFC vascular endothelial growth factor C [ Homo sapiens ] |
Official Symbol | VEGFC |
Synonyms | VEGFC; vascular endothelial growth factor C; VRP; VEGF-C; FLT4 ligand DHM; vascular endothelial growth factor-related protein; Flt4-L; |
Gene ID | 7424 |
mRNA Refseq | NM_005429 |
Protein Refseq | NP_005420 |
MIM | 601528 |
UniProt ID | P49767 |
◆ Recombinant Proteins | ||
VEGFC-11752Z | Recombinant Zebrafish VEGFC | +Inquiry |
VEGFC-6560H | Recombinant Human VEGFC Protein (Glu47-Trp413), His tagged | +Inquiry |
Vegfc-46R | Active Recombinant Rat VEGF-C152S Protein, His-tagged | +Inquiry |
VEGFC-1319M | Acitve Recombinant Mouse/Rat VEGFC protein(Ala108-Arg223), Fc-tagged | +Inquiry |
VEGFC-160V | Active Recombinant Human VEGFC Protein (126 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFC-1306RCL | Recombinant Rat VEGFC cell lysate | +Inquiry |
VEGFC-2768HCL | Recombinant Human VEGFC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All VEGFC Products
Required fields are marked with *
My Review for All VEGFC Products
Required fields are marked with *
0
Inquiry Basket