Recombinant Human VTN/TMSB4X protein

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human VTN/TMSB4X protein

Recombinant Human VTN/TMSB4X protein

VTN Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : VTN-95H
Product Overview : Recombinant human vitronectin (62–398aa) domain and full-length human Thymosin-b4 fusion protein cDNA were expressed in E. coli
Source : E. coli
Species : Human
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity : When coated onto tissue culture plastic, VTB fusion protein promotes one half maximal attachment of human cardiomytes cells in serum-free medium at< 0.1 µg / cm2. Maximum attachment should occur at approximately 0.5 µg / cm2.
AA Sequence : MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFSDKPDMAEIEKFDKSKLKKTETQE KNPLPSKETIEQEKQAGES
Endotoxin : < 30 EU per 1 µg of the protein by the LAL method
Purity : >95% by SDS-PAGE
Applications : 1. When coated at 0.5-1 ug/ ml per cm2 and combined with cardiomyocytes culture medium, this recombinant protein can be used as matrix protein for benefiting cardiomyocytes differentiation in vitro.
Storage : Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : VTN vitronectin [ Homo sapiens ]
Official Symbol : VTN
Synonyms : VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT;
Gene ID : 7448
mRNA Refseq : NM_000638
Protein Refseq : NP_000629
MIM : 193190
UniProt ID : P04004
Chromosome Location : 17q11.2
Pathway : ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem
Function : extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.