Active Recombinant Human VTN/TMSB4X protein

Cat.No. : VTN-95H
Product Overview : Recombinant human vitronectin (62–398aa) domain and full-length human Thymosin-b4 fusion protein cDNA were expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
Bio-activity : When coated onto tissue culture plastic, VTB fusion protein promotes one half maximal attachment of human cardiomytes cells in serum-free medium at< 0.1 µg / cm2. Maximum attachment should occur at approximately 0.5 µg / cm2.
AA Sequence : MTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGID SRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFT RINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQH QPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAP RPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRGGGGSGGGGSNIEFSDKPDMAEIEKFDKSKLKKTETQE KNPLPSKETIEQEKQAGES
Endotoxin : < 30 EU per 1 µg of the protein by the LAL method
Purity : >95% by SDS-PAGE
Applications : 1. When coated at 0.5-1 ug/ ml per cm2 and combined with cardiomyocytes culture medium, this recombinant protein can be used as matrix protein for benefiting cardiomyocytes differentiation in vitro.
Storage : Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name VTN vitronectin [ Homo sapiens ]
Official Symbol VTN
Synonyms VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT;
Gene ID 7448
mRNA Refseq NM_000638
Protein Refseq NP_000629
MIM 193190
UniProt ID P04004
Chromosome Location 17q11.2
Pathway ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem
Function extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VTN Products

Required fields are marked with *

My Review for All VTN Products

Required fields are marked with *

0
cart-icon
0
compare icon