Recombinant Human WNT1 protein, GST-tagged
| Cat.No. : | WNT1-7867H |
| Product Overview : | Recombinant Human WNT1 protein(228-323 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 228-323 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | TVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALD |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | WNT1 wingless-type MMTV integration site family, member 1 [ Homo sapiens ] |
| Official Symbol | WNT1 |
| Synonyms | WNT1; wingless-type MMTV integration site family, member 1; INT1; proto-oncogene Wnt-1; proto-oncogene Int-1 homolog; wingless-type MMTV integration site family, member 1 (oncogene INT1); |
| mRNA Refseq | NM_005430 |
| Protein Refseq | NP_005421 |
| MIM | 164820 |
| UniProt ID | P04628 |
| Gene ID | 7471 |
| ◆ Recombinant Proteins | ||
| WNT1-581H | Recombinant Human WNT1 Protein, His&GST-tagged | +Inquiry |
| WNT1-18563M | Recombinant Mouse WNT1 Protein | +Inquiry |
| WNT1-7867H | Recombinant Human WNT1 protein, GST-tagged | +Inquiry |
| Wnt1-001M | Active Recombinant Mouse Wnt-1/sFRP-1 Complex Protein | +Inquiry |
| WNT1-5621H | Recombinant Human WNT1 protein, His-GST&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT1-304HCL | Recombinant Human WNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT1 Products
Required fields are marked with *
My Review for All WNT1 Products
Required fields are marked with *



