Recombinant Human WNT1 protein, His-GST&Myc-tagged
Cat.No. : | WNT1-5621H |
Product Overview : | Recombinant Human WNT1 protein(P04628)(142-288aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 142-288aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.7 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHD |
Gene Name | WNT1 wingless-type MMTV integration site family, member 1 [ Homo sapiens ] |
Official Symbol | WNT1 |
Synonyms | WNT1; wingless-type MMTV integration site family, member 1; INT1; proto-oncogene Wnt-1; proto-oncogene Int-1 homolog; wingless-type MMTV integration site family, member 1 (oncogene INT1); |
Gene ID | 7471 |
mRNA Refseq | NM_005430 |
Protein Refseq | NP_005421 |
MIM | 164820 |
UniProt ID | P04628 |
◆ Recombinant Proteins | ||
WNT1-560H | Recombinant Human WNT1 | +Inquiry |
WNT1-581H | Recombinant Human WNT1 Protein, His&GST-tagged | +Inquiry |
WNT1-5621H | Recombinant Human WNT1 protein, His-GST&Myc-tagged | +Inquiry |
Wnt1-001M | Active Recombinant Mouse Wnt-1/sFRP-1 Complex Protein | +Inquiry |
Wnt1-5875M | Recombinant Mouse Wnt1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT1-304HCL | Recombinant Human WNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT1 Products
Required fields are marked with *
My Review for All WNT1 Products
Required fields are marked with *