Recombinant Human WNT5A protein, His-tagged

Cat.No. : WNT5A-5884H
Product Overview : Recombinant Human WNT5A protein(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Lys261-Val350
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 12 kDa
Storage : Store at -20°C/-80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV
Gene Name WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ]
Official Symbol WNT5A
Synonyms WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein;
Gene ID 7474
mRNA Refseq NM_001256105
Protein Refseq NP_001243034
MIM 164975
UniProt ID P41221

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WNT5A Products

Required fields are marked with *

My Review for All WNT5A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon