Recombinant Human WNT5A protein, His-tagged
| Cat.No. : | WNT5A-5884H |
| Product Overview : | Recombinant Human WNT5A protein(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Lys261-Val350 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 12 kDa |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV |
| Gene Name | WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ] |
| Official Symbol | WNT5A |
| Synonyms | WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein; |
| Gene ID | 7474 |
| mRNA Refseq | NM_001256105 |
| Protein Refseq | NP_001243034 |
| MIM | 164975 |
| UniProt ID | P41221 |
| ◆ Recombinant Proteins | ||
| WNT5A-20H | Recombinant Human WNT5A Full Length Protein | +Inquiry |
| Wnt5a-1492M | Recombinant Mouse Wnt5a protein, GST-tagged | +Inquiry |
| WNT5A-2474H | Recombinant Human WNT5A Full Length Protein | +Inquiry |
| WNT5A-5884H | Recombinant Human WNT5A protein, His-tagged | +Inquiry |
| WNT5A-4899Z | Recombinant Zebrafish WNT5A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT5A Products
Required fields are marked with *
My Review for All WNT5A Products
Required fields are marked with *
