Recombinant Human WNT5A protein, His-tagged
Cat.No. : | WNT5A-5884H |
Product Overview : | Recombinant Human WNT5A protein(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Lys261-Val350 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 12 kDa |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTV |
Gene Name | WNT5A wingless-type MMTV integration site family, member 5A [ Homo sapiens ] |
Official Symbol | WNT5A |
Synonyms | WNT5A; wingless-type MMTV integration site family, member 5A; protein Wnt-5a; hWNT5A; WNT 5A protein; WNT-5A protein; |
Gene ID | 7474 |
mRNA Refseq | NM_001256105 |
Protein Refseq | NP_001243034 |
MIM | 164975 |
UniProt ID | P41221 |
◆ Recombinant Proteins | ||
WNT5A-118H | Active Recombinant Human WNT5A Protein | +Inquiry |
WNT5A-20H | Recombinant Human WNT5A Full Length Protein | +Inquiry |
WNT5A-4899Z | Recombinant Zebrafish WNT5A | +Inquiry |
WNT5A-6450C | Recombinant Chicken WNT5A | +Inquiry |
WNT5A-2053H | Recombinant Human WNT5A, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT5A-293HCL | Recombinant Human WNT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT5A Products
Required fields are marked with *
My Review for All WNT5A Products
Required fields are marked with *