Recombinant Human WT1 Protein, His-tagged
Cat.No. : | WT1-001H |
Product Overview : | Recombinant Human WT1 Protein, His-tagged, expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 127-249 aa |
Tag : | His |
Molecular Mass : | 15 kDa |
AA Sequence : | MFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGHHHHHHHH |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
Gene Name | WT1 WT1 transcription factor [ Homo sapiens (human) ] |
Official Symbol | WT1 |
Synonyms | GUD; AWT1; WAGR; WT-1; WT33; NPHS4; WIT-2; WT1 |
Gene ID | 7490 |
MIM | 607102 |
UniProt ID | P19544 |
◆ Recombinant Proteins | ||
WT1-6605R | Recombinant Rat WT1 Protein | +Inquiry |
WT1-07HFL | Recombinant Full Length Human WT1 Protein, N-His-tagged | +Inquiry |
WT1-6261R | Recombinant Rat WT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WT1-1210H | Active Recombinant Human Wilms Tumor 1 | +Inquiry |
WT1-589H | Recombinant Human WT1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WT1-278HCL | Recombinant Human WT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WT1 Products
Required fields are marked with *
My Review for All WT1 Products
Required fields are marked with *