Recombinant Human WT1 Protein, His-tagged
| Cat.No. : | WT1-001H |
| Product Overview : | Recombinant Human WT1 Protein, His-tagged, expressed in E. coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 127-249 aa |
| Tag : | His |
| Molecular Mass : | 15 kDa |
| AA Sequence : | MFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose |
| Gene Name | WT1 WT1 transcription factor [ Homo sapiens (human) ] |
| Official Symbol | WT1 |
| Synonyms | GUD; AWT1; WAGR; WT-1; WT33; NPHS4; WIT-2; WT1 |
| Gene ID | 7490 |
| MIM | 607102 |
| UniProt ID | P19544 |
| ◆ Recombinant Proteins | ||
| WT1-1199H | Active Recombinant Human WT1, Flag-tagged | +Inquiry |
| WT1-30863TH | Recombinant Human WT1, FLAG-tagged | +Inquiry |
| WT1-6769C | Recombinant Chicken WT1 | +Inquiry |
| WT1-626H | Recombinant Human WT1 Protein, His-tagged | +Inquiry |
| WT1-18590M | Recombinant Mouse WT1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WT1-278HCL | Recombinant Human WT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WT1 Products
Required fields are marked with *
My Review for All WT1 Products
Required fields are marked with *
