Recombinant Human XCL1 protein
Cat.No. : | XCL1-05H |
Product Overview : | Recombinant Human XCL1 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 92 |
Description : | Chemokine (C motif) ligand (XCL1), as known as lymphotactin, is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The expression of lymphotactin is abundant in some activated T cells such as activated CD8+ T cells and other class I MHC restricted T cells. It is found in high levels in spleen, thymus, intestine and peripheral blood leukocytes, and at lower levels in lung, prostate gland and ovary. XCL1 induces its chemotactic function by binding to a chemokine receptor called XCR1. Recombinant Human XCL1 which is a single non-glycosylated polypeptide chains containing 92 amino acids and it shares approximately 60 % amino acid sequence homology with the murine and rat protein. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml. |
Molecular Mass : | Approximately 10.2 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids. |
AA Sequence : | GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Endotoxin : | Less than 1 EU/μg of rHuLymphotactin/XCL1 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | XCL1 |
Official Symbol | XCL1 |
Synonyms | XCL1; chemokine (C motif) ligand 1; LTN, SCYC1, small inducible cytokine subfamily C, member 1 (lymphotactin); lymphotactin; ATAC; LPTN; SCM 1; SCM 1a; SCM-1-alpha; lymphotaxin; cytokine SCM-1; c motif chemokine 1; XC chemokine ligand 1; single cysteine motif 1a; small-inducible cytokine C1; small inducible cytokine subfamily C, member 1 (lymphotactin); LTN; SCM1; SCM-1; SCM1A; SCYC1; SCM-1a; |
Gene ID | 6375 |
mRNA Refseq | NM_002995 |
Protein Refseq | NP_002986 |
MIM | 600250 |
UniProt ID | P47992 |
◆ Recombinant Proteins | ||
XCL1-27983TH | Recombinant Human XCL1 | +Inquiry |
XCL1-88H | Recombinant Human XCL1 Protein, Biotin-tagged | +Inquiry |
XCL1-6264R | Recombinant Rat XCL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Xcl1-7707M | Recombinant Mouse Xcl1 protein, His & T7-tagged | +Inquiry |
XCL1-001H | Active Recombinant Human XCL1,HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
XCL1-480MCL | Recombinant Mouse XCL1 cell lysate | +Inquiry |
XCL1-452CCL | Recombinant Cynomolgus XCL1 cell lysate | +Inquiry |
XCL1-001CCL | Recombinant Canine XCL1 cell lysate | +Inquiry |
XCL1-466HCL | Recombinant Human XCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All XCL1 Products
Required fields are marked with *
My Review for All XCL1 Products
Required fields are marked with *
0
Inquiry Basket