Recombinant Human XRN1 protein, His-tagged

Cat.No. : XRN1-12H
Product Overview : Recombinant Human XRN1 protein(Q8IZH2)(321-460 aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 321-460 aa
Form : Phosphate buffered saline
Molecular Mass : 18 kDa
AASequence : LGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYV
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name XRN1 5-3 exoribonuclease 1 [ Homo sapiens ]
Official Symbol XRN1
Synonyms XRN1; 5-3 exoribonuclease 1; SEP1; strand-exchange protein 1 homolog; FLJ41903; DKFZp434P0721; DKFZp686B22225; DKFZp686F19113;
Gene ID 54464
mRNA Refseq NM_001042604
Protein Refseq NP_001036069
MIM 607994
UniProt ID Q8IZH2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All XRN1 Products

Required fields are marked with *

My Review for All XRN1 Products

Required fields are marked with *

0
cart-icon
0
compare icon