Recombinant Human XRN1 protein, His-tagged

• Cat.No.: XRN1-12H
• Product Overview: Recombinant Human XRN1 protein(Q8IZH2)(321-460 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 321-460 aa
• Form: Phosphate buffered saline
• Molecular Mass: 18 kDa
• AASequence: LGGYINESGHLNLPRFEKYLVKLSDFDREHFSEVFVDLKWFESKVGNKYLNEAAGVAAEEARNYKEKKKLKGQENSLCWTALDKNEGEMITSKDNLEDETEDDDLFETEFRQYKRTYYMTKMGVDVVSDDFLADQAACYV
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: XRN1 5-3 exoribonuclease 1 [ Homo sapiens ]
• Official Symbol: XRN1
• Synonyms: XRN1; 5-3 exoribonuclease 1; SEP1; strand-exchange protein 1 homolog; FLJ41903; DKFZp434P0721; DKFZp686B22225; DKFZp686F19113
• Gene ID: 54464
• mRNA Refseq: NM_001042604
• Protein Refseq: NP_001036069
• MIM: 607994
• UniProt ID: Q8IZH2