Recombinant Human YTHDF2 protein, GST-tagged
Cat.No. : | YTHDF2-3765H |
Product Overview : | Recombinant Human YTHDF2 protein(339-565 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 31, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 339-565 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | YTHDF2 YTH domain family, member 2 [ Homo sapiens ] |
Official Symbol | YTHDF2 |
Synonyms | YTHDF2; YTH domain family, member 2; YTH domain family 2; YTH domain family protein 2; HGRG8; NY REN 2; 9430020E02Rik; CLL-associated antigen KW-14; high-glucose-regulated protein 8; renal carcinoma antigen NY-REN-2; NY-REN-2; |
Gene ID | 51441 |
mRNA Refseq | NM_001172828 |
Protein Refseq | NP_001166299 |
MIM | 610640 |
UniProt ID | Q9Y5A9 |
◆ Recombinant Proteins | ||
YTHDF2-5322H | Recombinant Human YTHDF2 protein(2-579aa), His-tagged | +Inquiry |
YTHDF2-5058R | Recombinant Rhesus Macaque YTHDF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ythdf2-4093M | Recombinant Mouse Ythdf2 Protein (Met1-Lys579, S238A, S419A), N-GST tagged | +Inquiry |
YTHDF2-5245R | Recombinant Rhesus monkey YTHDF2 Protein, His-tagged | +Inquiry |
YTHDF2-3765H | Recombinant Human YTHDF2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YTHDF2-236HCL | Recombinant Human YTHDF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YTHDF2 Products
Required fields are marked with *
My Review for All YTHDF2 Products
Required fields are marked with *