Recombinant Human YTHDF2 protein, GST-tagged

• Cat.No.: YTHDF2-3765H
• Product Overview: Recombinant Human YTHDF2 protein(339-565 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 339-565 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: YTHDF2 YTH domain family, member 2 [ Homo sapiens ]
• Official Symbol: YTHDF2
• Synonyms: YTHDF2; YTH domain family, member 2; YTH domain family 2; YTH domain family protein 2; HGRG8; NY REN 2; 9430020E02Rik; CLL-associated antigen KW-14; high-glucose-regulated protein 8; renal carcinoma antigen NY-REN-2; NY-REN-2
• Gene ID: 51441
• mRNA Refseq: NM_001172828
• Protein Refseq: NP_001166299
• MIM: 610640
• UniProt ID: Q9Y5A9