Recombinant Human ZBTB16 protein, His-tagged
| Cat.No. : | ZBTB16-3639H | 
| Product Overview : | Recombinant Human ZBTB16 protein(394-667 aa), fused to His tag, was expressed in E. coli. | 
| Availability | October 30, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 394-667 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | GMKSESRTIGEQCSVCGVELPDNEAVEQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHRQTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSHTGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEKPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTY | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. | 
| Gene Name | ZBTB16 zinc finger and BTB domain containing 16 [ Homo sapiens ] | 
| Official Symbol | ZBTB16 | 
| Synonyms | ZBTB16; zinc finger and BTB domain containing 16; zinc finger protein 145 (Kruppel like, expressed in promyelocytic leukemia) , ZNF145; zinc finger and BTB domain-containing protein 16; PLZF; zinc finger protein PLZF; zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia); ZNF145; | 
| Gene ID | 7704 | 
| mRNA Refseq | NM_001018011 | 
| Protein Refseq | NP_001018011 | 
| MIM | 176797 | 
| UniProt ID | Q05516 | 
| ◆ Recombinant Proteins | ||
| Zbtb16-7049M | Recombinant Mouse Zbtb16 Protein, Myc/DDK-tagged | +Inquiry | 
| ZBTB16-2383H | Recombinant Human ZBTB16 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ZBTB16-3639H | Recombinant Human ZBTB16 protein, His-tagged | +Inquiry | 
| ZBTB16-6744H | Recombinant Human ZBTB16 protein, His-tagged | +Inquiry | 
| ZBTB16-5544H | Recombinant Human ZBTB16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| ZBTB16-741HCL | Recombinant Human ZBTB16 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB16 Products
Required fields are marked with *
My Review for All ZBTB16 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            