Recombinant Human ZBTB48, His-tagged
| Cat.No. : | ZBTB48-31650TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 390-688 of Human ZBTB48 with an N terminal His tag; Predicted MWt 35 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 390-688 a.a. |
| Description : | ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 109 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | KKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFK HRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPHVC EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQ ASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVASR HQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTEC GYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLIIEDE KMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQR LCAEESFTGPGVLEPSLIITAAVPEDCDT |
| Gene Name | ZBTB48 zinc finger and BTB domain containing 48 [ Homo sapiens ] |
| Official Symbol | ZBTB48 |
| Synonyms | ZBTB48; zinc finger and BTB domain containing 48; GLI Kruppel family member HKR3 , HKR3; zinc finger and BTB domain-containing protein 48; ZNF855; |
| Gene ID | 3104 |
| mRNA Refseq | NM_005341 |
| Protein Refseq | NP_005332 |
| MIM | 165270 |
| Uniprot ID | P10074 |
| Chromosome Location | 1p36.3 |
| Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ZBTB48-31650TH | Recombinant Human ZBTB48, His-tagged | +Inquiry |
| ZBTB48-3784H | Recombinant Human ZBTB48 protein, His-tagged | +Inquiry |
| ZBTB48-3434C | Recombinant Chicken ZBTB48 | +Inquiry |
| ZBTB48-3785H | Recombinant Human ZBTB48 protein, GST-tagged | +Inquiry |
| ZBTB48-627HF | Recombinant Full Length Human ZBTB48 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZBTB48-213HCL | Recombinant Human ZBTB48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB48 Products
Required fields are marked with *
My Review for All ZBTB48 Products
Required fields are marked with *
