Recombinant Human ZG16B Protein, His-tagged
| Cat.No. : | ZG16B-1054H |
| Product Overview : | Recombinant Human ZG16B Protein (53-208aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 53-208 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 19.2 kDa |
| AA Sequence : | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKV FVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTT EPPVNLTYSANSPVGR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | ZG16B zymogen granule protein 16B [ Homo sapiens (human) ] |
| Official Symbol | ZG16B |
| Synonyms | EECP; PAUF; JCLN2; HRPE773; PRO1567 |
| Gene ID | 124220 |
| mRNA Refseq | NM_145252.2 |
| Protein Refseq | NP_660295.2 |
| UniProt ID | Q96DA0 |
| ◆ Recombinant Proteins | ||
| ZG16B-5618H | Recombinant Human ZG16B Protein (Gly53-Arg208), His tagged | +Inquiry |
| ZG16B-1024H | Recombinant Human ZG16B protein(53-208aa), His-tagged | +Inquiry |
| ZG16B-2388H | Recombinant Human ZG16B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZG16B-1054H | Recombinant Human ZG16B Protein, His-tagged | +Inquiry |
| ZG16B-1396HFL | Recombinant Full Length Human ZG16B Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZG16B-170HCL | Recombinant Human ZG16B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16B Products
Required fields are marked with *
My Review for All ZG16B Products
Required fields are marked with *
