Recombinant Human ZG16B Protein, His-tagged
Cat.No. : | ZG16B-1054H |
Product Overview : | Recombinant Human ZG16B Protein (53-208aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 53-208 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKV FVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTT EPPVNLTYSANSPVGR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ZG16B zymogen granule protein 16B [ Homo sapiens (human) ] |
Official Symbol | ZG16B |
Synonyms | EECP; PAUF; JCLN2; HRPE773; PRO1567 |
Gene ID | 124220 |
mRNA Refseq | NM_145252.2 |
Protein Refseq | NP_660295.2 |
UniProt ID | Q96DA0 |
◆ Recombinant Proteins | ||
ZG16B-5642C | Recombinant Cynomolgus monkey ZG16B protein, His-tagged | +Inquiry |
ZG16B-1054H | Recombinant Human ZG16B Protein, His-tagged | +Inquiry |
ZG16B-1396HFL | Recombinant Full Length Human ZG16B Protein, C-Flag-tagged | +Inquiry |
ZG16B-5618H | Recombinant Human ZG16B Protein (Gly53-Arg208), His tagged | +Inquiry |
ZG16B-1598H | Recombinant Human ZG16B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZG16B-170HCL | Recombinant Human ZG16B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZG16B Products
Required fields are marked with *
My Review for All ZG16B Products
Required fields are marked with *