Recombinant Marmota monax IFNG Protein, His-tagged
| Cat.No. : | IFNG-1254M |
| Product Overview : | Recombinant Marmota monax IFNG Protein (24-166aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Marmota monax (Woodchuck) |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 24-166 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 18.6 kDa |
| AA Sequence : | QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| ◆ Recombinant Proteins | ||
| IFNG-5433S | Recombinant Sheep IFNG protein, His-tagged | +Inquiry |
| Ifng-42M | Active Recombinant Mouse Ifng Protein (His23-Cys155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| Ifng-488M | Recombinant Mouse Ifng protein, His-tagged | +Inquiry |
| IFNG-807R | Recombinant Rabbit IFNG protein, His-tagged | +Inquiry |
| IFNg-51O | Recombinant Ovine IFN gamma | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
| IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
| IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
| IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
