Recombinant Marmota monax IFNG Protein, His-tagged
Cat.No. : | IFNG-1254M |
Product Overview : | Recombinant Marmota monax IFNG Protein (24-166aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Marmota monax (Woodchuck) |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-166 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 18.6 kDa |
AA Sequence : | QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
◆ Recombinant Proteins | ||
IFNG-2028R | Recombinant Rhesus Macaque IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNG-1164R | Recombinant Rhesus IFNG protein(Met1-Gln165), His-tagged | +Inquiry |
IFNG-801D | Recombinant Dog IFNG protein, His & T7-tagged | +Inquiry |
IFNG-24H | Active Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-2653R | Recombinant Rat IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket