Recombinant Medicago tribuloides MTR protein(26-87aa), His-SUMO-tagged
Cat.No. : | MTR-8655M |
Product Overview : | Recombinant Medicago tribuloides MTR protein(G7JRT6)(26-87aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Medicago tribuloides |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-87aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RPTPTVAVPTCDTIHAVAEAETCSSIVQKFNLLEAHFLEINPNINCVGIFVGQWVCVEGEVN |
◆ Recombinant Proteins | ||
MTR-1047M | Recombinant Medicago tribuloides MTR protein, His&Myc-tagged | +Inquiry |
MTR-8655M | Recombinant Medicago tribuloides MTR protein(26-87aa), His-SUMO-tagged | +Inquiry |
MTR-2778C | Recombinant Chicken MTR | +Inquiry |
MTR-8654M | Recombinant Medicago tribuloides MTR protein(29-81aa), His&Myc-tagged | +Inquiry |
MTR-301155H | Recombinant Human MTR protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTR Products
Required fields are marked with *
My Review for All MTR Products
Required fields are marked with *