Recombinant Mouse ADAMTS13 protein(904-1137aa), His-tagged

Cat.No. : ADAMTS13-2184M
Product Overview : Recombinant Mouse ADAMTS13 protein(Q769J6)(904-1137aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 904-1137aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.3 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Gene Name Adamts13 a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13 [ Mus musculus ]
Official Symbol ADAMTS13
Synonyms ADAMTS13; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13; A disintegrin and metalloproteinase with thrombospondin motifs 13; ADAM-TS13; ADAMTS-13; ADAM-TS 13; vWF-cleaving protease; ADAMTS13 isoform IAP-b; von Willebrand factor-cleaving protease; vWF-CP mRNA for von Willebrand factor-cleaving; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; Gm710; vWF-CP;
Gene ID 279028
mRNA Refseq NM_001001322
Protein Refseq NP_001001322

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADAMTS13 Products

Required fields are marked with *

My Review for All ADAMTS13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon