Recombinant Mouse ATP2B1 Protein, His-tagged

• Cat.No.: ATP2B1-11M
• Product Overview: Recombinant Mouse ATP2B1 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable P-type calcium transporter activity involved in regulation of presynaptic cytosolic calcium ion concentration and PDZ domain binding activity. Involved in several processes, including negative regulation of cytosolic calcium ion concentration; positive regulation of bone mineralization; and regulation of vascular associated smooth muscle contraction. Located in basolateral plasma membrane and immunological synapse. Is integral component of presynaptic membrane and integral component of synaptic vesicle membrane. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Orthologous to human ATP2B1 (ATPase plasma membrane Ca2+ transporting 1).
• Form: 50mM Tris, 0.3 M NaCl, 0.05% SKL, 1mM DTT, pH9.0.
• Molecular Mass: 13.8 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGDMANNSVAYSGVKNSLKEANHDGDFGITLTELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEA
• Purity: ＞90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.15 mg/ml

Gene Information

• Gene Name: Atp2b1 ATPase, Ca++ transporting, plasma membrane 1 [ Mus musculus (house mouse) ]
• Official Symbol: ATP2B1
• Synonyms: Pmca1; 2810442I22Rik; E130111D10Rik
• Gene ID: 67972
• mRNA Refseq: NM_001359506
• Protein Refseq: NP_001346435
• MIM: 108731
• UniProt ID: G5E829