Recombinant Human ATP2B1 Protein, His-tagged

• Cat.No.: ATP2B1-13H
• Product Overview: Recombinant Human ATP2B1 Protein(2-89 aa), fused with N-terminal His Tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 2-89 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AASequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 12 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: ATP2B1 ATPase, Ca++ transporting, plasma membrane 1 [ Homo sapiens ]
• Official Symbol: ATP2B1
• Synonyms: ATP2B1; ATPase, Ca++ transporting, plasma membrane 1; plasma membrane calcium-transporting ATPase 1; plasma membrane calcium transporting ATPase 1; PMCA1; plasma membrane calcium pump; PMCA1kb
• Gene ID: 490
• mRNA Refseq: NM_001001323
• Protein Refseq: NP_001001323
• MIM: 108731
• UniProt ID: P20020