Recombinant Human ATP2B1 protein, His-tagged
Cat.No. : | ATP2B1-120H |
Product Overview : | Recombinant Human ATP2B1 protein(P20020)(Phe181-Ser360), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Phe181-Ser360 |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C to -80°C. |
Molecular Mass : | 21 kDa |
AA Sequence : | FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS |
Official Symbol | ATP2B1 |
Synonyms | ATP2B1; ATPase, Ca++ transporting, plasma membrane 1; plasma membrane calcium-transporting ATPase 1; plasma membrane calcium transporting ATPase 1; PMCA1; plasma membrane calcium pump; PMCA1kb; |
Gene ID | 490 |
mRNA Refseq | NM_001001323 |
Protein Refseq | NP_001001323 |
MIM | 108731 |
UniProt ID | P20020 |
◆ Recombinant Proteins | ||
ATP2B1-120H | Recombinant Human ATP2B1 protein, His-tagged | +Inquiry |
ATP2B1-972H | Recombinant Human ATP2B1 protein, GST-tagged | +Inquiry |
ATP2B1-517R | Recombinant Rat ATP2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP2B1-11M | Recombinant Mouse ATP2B1 Protein, His-tagged | +Inquiry |
ATP2B1-4035C | Recombinant Chicken ATP2B1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP2B1 Products
Required fields are marked with *
My Review for All ATP2B1 Products
Required fields are marked with *
0
Inquiry Basket