Recombinant Human ATP2B1 protein, His-tagged

Cat.No. : ATP2B1-120H
Product Overview : Recombinant Human ATP2B1 protein(P20020)(Phe181-Ser360), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Phe181-Ser360
Form : Phosphate buffered saline
Storage : Store at -20°C to -80°C.
Molecular Mass : 21 kDa
AA Sequence : FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
Official Symbol ATP2B1
Synonyms ATP2B1; ATPase, Ca++ transporting, plasma membrane 1; plasma membrane calcium-transporting ATPase 1; plasma membrane calcium transporting ATPase 1; PMCA1; plasma membrane calcium pump; PMCA1kb;
Gene ID 490
mRNA Refseq NM_001001323
Protein Refseq NP_001001323
MIM 108731
UniProt ID P20020

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP2B1 Products

Required fields are marked with *

My Review for All ATP2B1 Products

Required fields are marked with *

0
cart-icon