Recombinant Human ATP2B1 protein, His-tagged
| Cat.No. : | ATP2B1-120H |
| Product Overview : | Recombinant Human ATP2B1 protein(P20020)(Phe181-Ser360), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Phe181-Ser360 |
| Form : | Phosphate buffered saline |
| Storage : | Store at -20°C to -80°C. |
| Molecular Mass : | 21 kDa |
| AA Sequence : | FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS |
| Official Symbol | ATP2B1 |
| Synonyms | ATP2B1; ATPase, Ca++ transporting, plasma membrane 1; plasma membrane calcium-transporting ATPase 1; plasma membrane calcium transporting ATPase 1; PMCA1; plasma membrane calcium pump; PMCA1kb; |
| Gene ID | 490 |
| mRNA Refseq | NM_001001323 |
| Protein Refseq | NP_001001323 |
| MIM | 108731 |
| UniProt ID | P20020 |
| ◆ Recombinant Proteins | ||
| ATP2B1-4035C | Recombinant Chicken ATP2B1 | +Inquiry |
| ATP2B1-11M | Recombinant Mouse ATP2B1 Protein, His-tagged | +Inquiry |
| ATP2B1-13H | Recombinant Human ATP2B1 Protein, His-tagged | +Inquiry |
| ATP2B1-2122M | Recombinant Mouse ATP2B1 Protein | +Inquiry |
| ATP2B1-120H | Recombinant Human ATP2B1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP2B1 Products
Required fields are marked with *
My Review for All ATP2B1 Products
Required fields are marked with *
