Recombinant Mouse BMP3 Protein (359-468 aa), His-tagged
| Cat.No. : | BMP3-2588M |
| Product Overview : | Recombinant Mouse BMP3 Protein (359-468 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the C-terminal. Research Area: Developmental Biology. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 359-468 aa |
| Description : | Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 14.4 kDa |
| AA Sequence : | QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | Bmp3 bone morphogenetic protein 3 [ Mus musculus ] |
| Official Symbol | BMP3 |
| Synonyms | BMP3; bone morphogenetic protein 3; |
| Gene ID | 12158 |
| UniProt ID | Q8BHE5 |
| ◆ Recombinant Proteins | ||
| BMP3-257H | Recombinant Human BMP3 Protein, His/GST-tagged | +Inquiry |
| BMP3-2598H | Recombinant Human BMP3 protein, Myc-tagged | +Inquiry |
| BMP3-2545H | Recombinant Human BMP3 Protein (363-472 aa), His-Myc-tagged | +Inquiry |
| BMP3-997R | Recombinant Rat BMP3 Protein | +Inquiry |
| BMP3-26427TH | Recombinant Human BMP3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP3 Products
Required fields are marked with *
My Review for All BMP3 Products
Required fields are marked with *



