Recombinant Mouse Bnip3 Transmembrane protein, His-tagged
| Cat.No. : | Bnip3-2355M | 
| Product Overview : | Recombinant Mouse Bnip3 protein(O55003)(50-187aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 50-187aa | 
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. | 
| Molecular Mass : | 21.3 kDa | 
| AA Sequence : | RSSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. | 
| Gene Name | Bnip3 BCL2/adenovirus E1B interacting protein 3 [ Mus musculus ] | 
| Official Symbol | Bnip3 | 
| Synonyms | BNIP3; BCL2/adenovirus E1B interacting protein 3; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3; BCL2/adenovirus E1B interacting protein 1, NIP3; BCL2/adenovirus E1B 19kDa-interacting protein 1, NIP3; BCL2/adenovirus E1B 19 kDa-interacting protein 1, NIP3; Nip3; | 
| Gene ID | 12176 | 
| mRNA Refseq | NM_009760 | 
| Protein Refseq | NP_033890 | 
| ◆ Recombinant Proteins | ||
| BNIP3-2403M | Recombinant Mouse BNIP3 Protein (1-156 aa), His-tagged | +Inquiry | 
| RFL18293HF | Recombinant Full Length Human Bcl2/Adenovirus E1B 19 Kda Protein-Interacting Protein 3(Bnip3) Protein, His-Tagged | +Inquiry | 
| BNIP3-810H | Recombinant Human BNIP3 protein, GST-tagged | +Inquiry | 
| BNIP3-10262H | Recombinant Human BNIP3 protein, His-tagged | +Inquiry | 
| BNIP3-294H | Recombinant Human BNIP3 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| BNIP3-8423HCL | Recombinant Human BNIP3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bnip3 Products
Required fields are marked with *
My Review for All Bnip3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            