Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
83 |
Description : |
CCL19, also known as EBI1 Ligands chemokine (ELC) and macrophage inflammatory protein-3-beta, is encoded by the CCL19 gene which is located on chromosome 4 in mouse. The protein is expressed at high levels in thymus and lymph nodes, with intermediate levels in trachea and colon and low levels in stomach, lung and some other organs. CCL19 is signal through CCR7 and chemotaxis of T and B lymphocytes and myeloid progenitor cells. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human mature dendritic cells is in a concentration range of 10-100 ng/ml. |
Molecular Mass : |
Approximately 9.2 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids. |
AA Sequence : |
GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
Endotoxin : |
Less than 1 EU/μg of rMuMIP-3β/CCL19 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |