Recombinant Mouse Ccl3 Protein, His-tagged
Cat.No. : | Ccl3-7337M |
Product Overview : | Recombinant mouse CCL3 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-92 |
Description : | Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils. |
Form : | Liquid |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Sodium citrate buffer (pH 3.5) containing 10 % glycerol |
Gene Name | Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl3 |
Synonyms | Ccl3; chemokine (C-C motif) ligand 3; Mi; CCL; Scy; LD78; MIP-; MIP1; MIP1-; Mip1a; Scya3; G0S19-; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha; C-C motif chemokine 3; L2G25B; MIP-1-alpha; MIP1 (a); SIS-alpha; TY-5; heparin-binding chemotaxis protein; macrophage inflammatory protein 1-alpha; macrophage inflammatory protein-1alpha; small-inducible cytokine A3 |
Gene ID | 20302 |
mRNA Refseq | NM_011337 |
Protein Refseq | NP_035467 |
UniProt ID | P10855 |
◆ Recombinant Proteins | ||
CCL3-475H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
CCL3-2949HF | Recombinant Full Length Human CCL3 Protein, GST-tagged | +Inquiry |
Ccl3-2977M | Recombinant Mouse Ccl3 Protein | +Inquiry |
CCL3-519R | Recombinant Rhesus Macaque CCL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ccl3-7197M | Recombinant Mouse Chemokine (C-C motif) Ligand 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl3 Products
Required fields are marked with *
My Review for All Ccl3 Products
Required fields are marked with *