Recombinant Mouse Cct2 protein, Avi-tagged, Biotinylated
| Cat.No. : | Cct2-5285M |
| Product Overview : | Biotinylated Recombinant Mouse Cct2 protein(P80314)(2-535 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Avi |
| Protein Length : | 2-535 aa |
| Conjugation/Label : | Biotin |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | ASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAAL MVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKI HPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTK LAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIAN TGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPE QLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIH FSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAV TQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMK EGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Conjugation : | Biotin |
| Gene Name | Cct2 chaperonin containing Tcp1, subunit 2 (beta) [ Mus musculus ] |
| Official Symbol | Cct2 |
| Synonyms | CCT2; chaperonin containing Tcp1, subunit 2 (beta); T-complex protein 1 subunit beta; CCT-beta; TCP-1-beta; chaperonin subunit 2 (beta); Cctb; |
| Gene ID | 12461 |
| mRNA Refseq | NM_007636 |
| Protein Refseq | NP_031662 |
| ◆ Recombinant Proteins | ||
| CCT2-889R | Recombinant Rat CCT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cct2-5287M | Recombinant Mouse Cct2 protein | +Inquiry |
| Cct2-5285M | Recombinant Mouse Cct2 protein, Avi-tagged, Biotinylated | +Inquiry |
| CCT2-1742H | Recombinant Human CCT2 Protein (2-535 aa), His-tagged | +Inquiry |
| CCT2-3023M | Recombinant Mouse CCT2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCT2-7691HCL | Recombinant Human CCT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cct2 Products
Required fields are marked with *
My Review for All Cct2 Products
Required fields are marked with *
