Recombinant Mouse CD46 Protein (45-329 aa), His-tagged

• Cat.No.: CD46-394M
• Product Overview: Recombinant Mouse CD46 Protein (45-329 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 45-329 aa
• Description: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 35.9 kDa
• AA Sequence: CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: Cd46 CD46 antigen, complement regulatory protein [ Mus musculus ]
• Official Symbol: CD46
• Synonyms: CD46; Mcp
• Gene ID: 17221
• mRNA Refseq: NM_010778
• Protein Refseq: NP_034908
• UniProt ID: O88174