"CD46" Related Products

Expand
Expand
Expand

Recombinant Mouse CD46 Protein (45-329 aa), His-tagged

Cat.No.: CD46-394M
Product Overview: Recombinant Mouse CD46 Protein (45-329 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
Description: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.
Source: E. coli
Species: Mouse
Tag : His
Form: Tris-based buffer, 50% glycerol
Molecular Mass: 35.9 kDa
Protein length: 45-329 aa
AA Sequence: CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name: Cd46 CD46 antigen, complement regulatory protein [ Mus musculus ]
Official Symbol: CD46
Synonyms: CD46; Mcp;
Gene ID: 17221
mRNA Refseq: NM_010778
Protein Refseq: NP_034908
UniProt ID: O88174

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.