Recombinant Mouse CD86 Protein, Fc-tagged

Cat.No. : CD86-597M
Product Overview : Recombinant Mouse CD86 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : 309
Description : Predicted to enable signaling receptor binding activity. Involved in several processes, including CD40 signaling pathway; activation of phospholipase C activity; and positive regulation of macromolecule metabolic process. Acts upstream of or within several processes, including cellular response to lipopolysaccharide; defense response to virus; and positive regulation of T cell proliferation. Located in external side of plasma membrane and intracellular membrane-bounded organelle. Is expressed in central nervous system and retina. Used to study Guillain-Barre syndrome. Human ortholog(s) of this gene implicated in several diseases, including Henoch-Schoenlein purpura; autoimmune disease (multiple); chronic lymphocytic leukemia; chronic obstructive pulmonary disease; and systemic scleroderma. Orthologous to human CD86 (CD86 molecule).
Form : Lyophilized
Molecular Mass : 52 kDa
AA Sequence : MDPRCTMGLAILIFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKEITASVTVALLLVMLLIIVCHKKPNQPSRPSNTASKLERDSNADRETINLKELEPQIASAKPNAE
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Cd86 CD86 antigen [ Mus musculus (house mouse) ]
Official Symbol CD86
Synonyms CD86; CD86 antigen; T-lymphocyte activation antigen CD86; activation B7-2 antigen; early T cell costimulatory molecule-1; early T-cell costimulatory molecule 1; B7; B70; MB7; B7-2; B7.2; CLS1; Ly58; ETC-1; Ly-58; MB7-2; Cd28l2; TS/A-2;
Gene ID 12524
mRNA Refseq NM_019388
Protein Refseq NP_062261
UniProt ID P42082

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD86 Products

Required fields are marked with *

My Review for All CD86 Products

Required fields are marked with *

0
cart-icon
0
compare icon