Recombinant Mouse Cdh17 protein, His-Myc-tagged
Cat.No. : | Cdh17-479M |
Product Overview : | Recombinant Mouse Cdh17 protein(Q9R100)(173-253aa), fused to C-terminal His and Myc tags, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His&Myc |
Protein Length : | 173-253aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 12.7kDa |
AA Sequence : | INDVMYFQIDSKTGAISLTPEGSQELDPVKNPSYNLVVSVKDMGGQSENSFSDTTYVDISIRENIWKAPEPVEIRENSTDP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Cdh17 cadherin 17 [ Mus musculus ] |
Official Symbol | Cdh17 |
Synonyms | CDH17; cadherin 17; cadherin-17; P130; LI-cadherin; BILL-cadherin; liver-intestine cadherin; HPT-1; HPT-1/LI; |
Gene ID | 12557 |
mRNA Refseq | NM_019753 |
Protein Refseq | NP_062727 |
◆ Recombinant Proteins | ||
CDH17-0978H | Recombinant Human CDH17 Protein, GST-Tagged | +Inquiry |
CDH17-947R | Recombinant Rat CDH17 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH17-1524H | Recombinant Human CDH17 protein, His-tagged | +Inquiry |
CDH17-1425H | Recombinant Human CDH17 protein, His-tagged, Biotinylated | +Inquiry |
CDH17-2094H | Recombinant Human CDH17 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH17-2032HCL | Recombinant Human CDH17 cell lysate | +Inquiry |
CDH17-1483RCL | Recombinant Rat CDH17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cdh17 Products
Required fields are marked with *
My Review for All Cdh17 Products
Required fields are marked with *
0
Inquiry Basket