Recombinant Mouse CELA2A Protein (1-134 aa), His-tagged
Cat.No. : | CENPA-1359M |
Product Overview : | Recombinant Mouse CELA2A Protein (1-134 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-134 aa |
Description : | Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assbly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro). |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 17.5 kDa |
AA Sequence : | MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Cenpa centromere protein A [ Mus musculus ] |
Official Symbol | CENPA |
Synonyms | CENPA; centrosomin A; Cenp-A; |
Gene ID | 12615 |
mRNA Refseq | NM_007681 |
Protein Refseq | NP_031707 |
UniProt ID | O35216 |
◆ Recombinant Proteins | ||
CENPA-6623H | Recombinant Human CENPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CENPA-3313HF | Recombinant Full Length Human CENPA Protein, GST-tagged | +Inquiry |
CENPA-617H | Recombinant Human Centromere Protein A, His-tagged | +Inquiry |
CENPA-1575M | Recombinant Mouse CENPA Protein, His (Fc)-Avi-tagged | +Inquiry |
CENPA-3281M | Recombinant Mouse CENPA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CENPA-7586HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
CENPA-7587HCL | Recombinant Human CENPA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CENPA Products
Required fields are marked with *
My Review for All CENPA Products
Required fields are marked with *
0
Inquiry Basket