Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged

Cat.No. : CHRNA1-406M
Product Overview : Recombinant Mouse CHRNA1 Protein (21-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 21-230 aa
Description : After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 40.5 kDa
AA Sequence : SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name Chrna1 cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [ Mus musculus ]
Official Symbol CHRNA1
Synonyms CHRNA1; Acra; Achr-1; AI385656; AI608266;
Gene ID 11435
mRNA Refseq NM_007389
Protein Refseq NP_031415
UniProt ID P04756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA1 Products

Required fields are marked with *

My Review for All CHRNA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon