Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged
Cat.No. : | CHRNA1-406M |
Product Overview : | Recombinant Mouse CHRNA1 Protein (21-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-230 aa |
Description : | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.5 kDa |
AA Sequence : | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Chrna1 cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [ Mus musculus ] |
Official Symbol | CHRNA1 |
Synonyms | CHRNA1; Acra; Achr-1; AI385656; AI608266; |
Gene ID | 11435 |
mRNA Refseq | NM_007389 |
Protein Refseq | NP_031415 |
UniProt ID | P04756 |
◆ Recombinant Proteins | ||
CHRNA1-2696T | Recombinant Tetronarce Californica CHRNA1 Protein (25-234 aa), His-sumostar-tagged | +Inquiry |
CHRNA1-1662M | Recombinant Mouse CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA1-1047R | Recombinant Rat CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA1-1472P | Recombinant Pacific electric ray CHRNA1 protein, His-tagged | +Inquiry |
Chrna1-778R | Recombinant Rat Chrna1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
0
Inquiry Basket