Recombinant Mouse CHRNA1 Protein (21-230 aa), His-SUMO-tagged
| Cat.No. : | CHRNA1-406M |
| Product Overview : | Recombinant Mouse CHRNA1 Protein (21-230 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 21-230 aa |
| Description : | After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma mbrane. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 40.5 kDa |
| AA Sequence : | SEHETRLVAKLFEDYSSVVRPVEDHREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKEARGWKHWVFYSCCPTTPYLDITYHFVMQRL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Chrna1 cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) [ Mus musculus ] |
| Official Symbol | CHRNA1 |
| Synonyms | CHRNA1; Acra; Achr-1; AI385656; AI608266; |
| Gene ID | 11435 |
| mRNA Refseq | NM_007389 |
| Protein Refseq | NP_031415 |
| UniProt ID | P04756 |
| ◆ Recombinant Proteins | ||
| CHRNA1-292P | Recombinant Pacific electric ray CHRNA1 protein(25-234aa) | +Inquiry |
| CHRNA1-1389R | Recombinant Rat CHRNA1 Protein | +Inquiry |
| CHRNA1-1662M | Recombinant Mouse CHRNA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHRNA1-4333T | Recombinant Torpedo californica CHRNA1 protein, His&Myc-tagged | +Inquiry |
| CHRNA1-2696T | Recombinant Tetronarce Californica CHRNA1 Protein (25-234 aa), His-sumostar-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHRNA1-7517HCL | Recombinant Human CHRNA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *



