"COL3A1" Related Products

Expand
Expand
Expand

Recombinant Mouse Col3a1 protein, His-tagged

Cat.No.: Col3a1-09M
Product Overview: Recombinant Mouse Col3a1(Gln155-Gly1219) fused with His tag at C-terminal was expressed in HEK293.
Description: Collagen alpha-1(III) chain(Col3a1) is a secreted protein and belongs to the fibrillar collagen family.It contains 1 fibrillar collagen NC1 domain and 1 VWFC domain. Collagen alpha-1(III) chain is a fibrillar collagen that is found in extensible connective tissues such as skin, lung, and the vascular system, frequently in association with type I collagen. The COL3A1 gene produces the components of type III collagen, called pro-alpha1(III) chains. Three copies of this chain combine to make a molecule of type III procollagen. These triple-stranded, rope-like procollagen molecules must be processed by enzymes outside the cell to remove extra protein segments from their ends. Once these molecules are processed, the collagen molecules arrange themselves into long, thin fibrils. Within these fibrils, the individual collagen molecules are cross-linked to one another. These cross-links result in the formation of very strong mature type III collagen fibrils, which are found in the spaces around cells.
Source: HEK293
Species: Mouse
Tag: His
Form: Supplied as a 0.2 μm filtered solution of 20mM HAc-NaAc,150mM NaCl, pH4.5.
AA Sequence: QFDSYDVKSGVGGMGGYPGPAGPPGPPGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGA LGPAGPAGKDGESGRPGRPGERGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKG ENGLPGDNGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAK GEVGPAGSPGSNGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGP PGPAGTNGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPG AAGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGSPGGP GNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGGPGLPGPAGK NGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGPKGEVGAPGAPGGKG DSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGSPGLQGMPGERGGPGSPGPK GEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGEGGSPGLPGIAGPRGGPGERGEHGP PGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGPAGPTGSSGPAGPPGPQGVKGERGSPGGPG TAGFPGGRGLPGPPGNNGNPGPPGPSGAPGKDGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPP GAQGPPGSPGPLGIAGLTGARGLAGPPGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGL PGQPGTAGEPGRDGNPGSDGQPGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRG ETGPAGPSGAPGPAGARGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAI GSPGPAGPRGPVGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGP CCGGGAAAIAGVGGEKSGGFSPYYGVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
Gene Name: Col3a1 collagen, type III, alpha 1 [ Mus musculus ]
Official Symbol: Col3a1
Synonyms: COL3A1; collagen, type III, alpha 1; collagen alpha-1(III) chain; procollagen, type III, alpha 1; minisatellite 10w detected by probe MMS10; Ms10w; Col3a-1; MMS10-W; AW550625; mKIAA4231; KIAA4231;
Gene ID: 12825
mRNA Refseq: NM_009930
Protein Refseq: NP_034060
MIM:
UniProt ID: P08121
Chromosome Location: 1 C1.1; 1 23.67 cM
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem;
Function: SMAD binding; extracellular matrix structural constituent; integrin binding; platelet-derived growth factor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.