Recombinant Mouse Cry2 protein, His&Myc-tagged
Cat.No. : | Cry2-5633M |
Product Overview : | Recombinant Mouse Cry2 protein(Q9R194)(1-592aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-592a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 74.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQAGSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS |
Gene Name | Cry2 cryptochrome 2 (photolyase-like) [ Mus musculus ] |
Official Symbol | Cry2 |
Synonyms | CRY2; cryptochrome 2 (photolyase-like); cryptochrome-2; AV006279; D130054K12Rik; |
Gene ID | 12953 |
mRNA Refseq | NM_001113333 |
Protein Refseq | NP_001106804 |
◆ Recombinant Proteins | ||
CRY2-1159H | Recombinant Human CRY2, MYC/DDK-tagged | +Inquiry |
CRY2-647H | Recombinant Human CRY2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CRY2-5566A | Recombinant Mouse-ear cress CRY2 Protein (Met1-Lys612), N-His tagged | +Inquiry |
CRY2-5817C | Recombinant Chicken CRY2 | +Inquiry |
CRY2-2390R | Recombinant Rat CRY2 Protein (1-594 aa), His-SUMO-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRY2-7268HCL | Recombinant Human CRY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cry2 Products
Required fields are marked with *
My Review for All Cry2 Products
Required fields are marked with *
0
Inquiry Basket