Recombinant Mouse Cxcl9 protein

Cat.No. : Cxcl9-612M
Product Overview : Recombinant Mouse Cxcl9 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 105
Description : CXCL9 belongs to the CXC chemokine family and also known as Monokine induced by gamma interferon (MIG). It is a T-cell chemoattractant induced by IFN-γ. CXCL9 is closely related to two other CXC chemokines called CXCL10 and CXCL11, additionally they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. It is a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response and chemotactic for activated T-cells. Recombinant murine CXCL9 contains 105 amino acids which is a single non-glycosylated polypeptide chain. Furthermore, The murine CXCL9 shares 75% and 88% a.a. sequence identity with human and rat CXCL9.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 0.1-1.0 ng/ml.
Molecular Mass : Approximately 12.2 kDa, a single non-glycosylated polypeptide chain containing 105 amino acids.
AA Sequence : TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Endotoxin : Less than 1 EU/µg of rMuMIG/CXCL9 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl9
Official Symbol Cxcl9
Synonyms CXCL9; chemokine (C-X-C motif) ligand 9; C-X-C motif chemokine 9; M119; protein m119; small-inducible cytokine B9; gamma interferon-induced monokine; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small inducible cytokine B subfamily (Cys-X-Cys), member 9; CMK; Mig; MuMIG; Scyb9; crg-10; BB139920;
Gene ID 17329
mRNA Refseq NM_008599
Protein Refseq NP_032625
UniProt ID P18340

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl9 Products

Required fields are marked with *

My Review for All Cxcl9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon