Recombinant Mouse Efnb2 Protein, His-tagged
Cat.No. : | Efnb2-7194M |
Product Overview : | Recombinant Mouse Efnb2 protein with a His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 29-232 |
Description : | Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons. |
Form : | Liquid |
Molecular Mass : | 23.4 kDa |
AA Sequence : | RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFALEHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Efnb2 ephrin B2 [ Mus musculus (house mouse) ] |
Official Symbol | Efnb2 |
Synonyms | Efnb2; ephrin B2; Ep; Epl; Ler; ELF-; Epl5; Htk-; LERK; NLER; ELF-2; Eplg5; Htk-L; Lerk5; LERK-5; NLERK-1; ephrin-B2; EPH-related receptor tyrosine kinase ligand 5; HTK ligand |
Gene ID | 13642 |
mRNA Refseq | NM_010111 |
Protein Refseq | NP_034241 |
UniProt ID | P52800 |
◆ Recombinant Proteins | ||
EFNB2-2035H | Recombinant Human EFNB2 Protein (Ile28-Ala229), His tagged | +Inquiry |
EFNB2-2240H | Active Recombinant Human EFNB2, Fc-His tagged | +Inquiry |
Efnb2-1734M | Recombinant Mouse Ephrin B2, Fc-His | +Inquiry |
Efnb2-3315M | Active Recombinant Mouse Efnb2 protein, His-tagged | +Inquiry |
Efnb2-1409M | Recombinant Mouse Efnb2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB2-965CCL | Recombinant Canine EFNB2 cell lysate | +Inquiry |
EFNB2-2405MCL | Recombinant Mouse EFNB2 cell lysate | +Inquiry |
EFNB2-936HCL | Recombinant Human EFNB2 cell lysate | +Inquiry |
EFNB2-1540RCL | Recombinant Rat EFNB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efnb2 Products
Required fields are marked with *
My Review for All Efnb2 Products
Required fields are marked with *
0
Inquiry Basket