Recombinant Mouse Fabp1 protein

Cat.No. : Fabp1-659M
Product Overview : Recombinant Mouse Fabp1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 127
Description : The fatty-acid-binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as eicosanoids and retinoids. These proteins are thought to facilitate the transfer of fatty acids between extra- and intracellular membranes. Fatty acid-binding protein 1 (FABP1) encoded by the FABP1 gene, also known as liver-type fatty acid-binding protein (L-FABP), is a member of FABP family and it is a small, highly conserved, cytoplasmic proteins. In addition, FABP1 binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. Furthermore, it may be involved in intracellular lipid transport. Through amino acid sequence comparison, murine FABP1 shares 84% and 94% a.a. sequence identity with human and rat FABP1.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, 2 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The binding affinity of rMuFABP1 for the synthetic ligand cis-parinaric acid has been measured by fluorescence titration. Half maximal fluorescence of 2.5 μM rMuFABP1 is achieved with approximately 5 μM cis-paranaric acid.
Molecular Mass : Approximately 14.2 kDa, a single non-glycosylated polypeptide chain containing 127 amino acids.
AA Sequence : MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVRNEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVYKRVSKRI
Endotoxin : Less than 1 EU/µg of rMuFABP1 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Fabp1
Official Symbol Fabp1
Synonyms FABP1; fatty acid binding protein 1, liver;
Gene ID 54005
mRNA Refseq NM_017399.5
Protein Refseq NP_059095.1
UniProt ID P12710

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fabp1 Products

Required fields are marked with *

My Review for All Fabp1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon