Recombinant Mouse Fgf15 Protein, His-SUMO-tagged Fgf15-1213M

Recombinant Mouse Fgf15 Protein, His-SUMO-tagged

PRODUCTS

Home / Products / Recombinant Mouse Fgf15 Protein, His-SUMO-tagged

Recombinant Mouse Fgf15 Protein, His-SUMO-tagged

Fgf15 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Fgf15-1213M
Product Overview : Recombinant Mouse Fgf15 Protein (26-218aa) was expressed in E. coli with N-terminal His-SUMO-tag.
Source : E. coli
Species : Mouse
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 38.5 kDa
AA Sequence : RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALK
TIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQK
PSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : Fgf15 fibroblast growth factor 15 [ Mus musculus (house mouse) ]
Official Symbol : Fgf15
Synonyms : FGF19; Fgf15
Gene ID : 14170
mRNA Refseq : NM_008003.2
Protein Refseq : NP_032029.1
UniProt ID : O35622

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy