Recombinant Mouse Fgf15 Protein, His-SUMO-tagged
Cat.No. : | Fgf15-1213M |
Product Overview : | Recombinant Mouse Fgf15 Protein (26-218aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 26-218 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 38.5 kDa |
AA Sequence : | RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALK TIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQK PSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Fgf15 fibroblast growth factor 15 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf15 |
Synonyms | FGF19; Fgf15 |
Gene ID | 14170 |
mRNA Refseq | NM_008003.2 |
Protein Refseq | NP_032029.1 |
UniProt ID | O35622 |
◆ Recombinant Proteins | ||
FGF15-5843M | Recombinant Mouse FGF15 Protein | +Inquiry |
Fgf15-1213M | Recombinant Mouse Fgf15 Protein, His-SUMO-tagged | +Inquiry |
Fgf15-499M | Recombinant Mouse Fgf15, His-tagged | +Inquiry |
FGF15-30R | Recombinant Rat FGF15 protein, His-tagged | +Inquiry |
Fgf15-01M | Recombinant Mouse Fgf15 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf15 Products
Required fields are marked with *
My Review for All Fgf15 Products
Required fields are marked with *
0
Inquiry Basket