Recombinant Mouse Fgf20 protein, His-tagged
| Cat.No. : | Fgf20-2912M |
| Product Overview : | Recombinant Mouse Fgf20 protein(Q9ESL9)(1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-211aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 27.7 kDa |
| AA Sequence : | MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Fgf20 fibroblast growth factor 20 [ Mus musculus ] |
| Official Symbol | Fgf20 |
| Synonyms | FGF20; fibroblast growth factor 20; FGF-20; |
| Gene ID | 80857 |
| mRNA Refseq | NM_030610 |
| Protein Refseq | NP_085113 |
| ◆ Recombinant Proteins | ||
| FGF20-12869H | Recombinant Human FGF20, GST-tagged | +Inquiry |
| FGF20-5848M | Recombinant Mouse FGF20 Protein | +Inquiry |
| FGF20-15H | Active Recombinant Human FGF20 protein, His-tagged | +Inquiry |
| FGF20-033H | Active Recombinant Human FGF20 Protein | +Inquiry |
| FGF20-331H | Active Recombinant Human FGF20 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF20-6243HCL | Recombinant Human FGF20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf20 Products
Required fields are marked with *
My Review for All Fgf20 Products
Required fields are marked with *
