Recombinant Mouse FST Protein
Cat.No. : | FST-102M |
Product Overview : | Recombinant Mouse FST Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Follistatin is an autocrine, activin-binding protein that is ubiquitously expressed with highest expression levels being in the ovary and skin. Follistatin negatively regulates the signaling of transforming growth factor beta (TGF-β) family members, such as activin, bone morphogenetic proteins (BMPs), myostatin, growth differentiation factor 11 (GDF-11), and TGF-β1. Follistatin functions as an antagonist by binding TGF-β family members to block interaction with their signaling receptors. Follistatin also inhibits the secretion of follicle-stimulating hormone (FSH) from the anterior pituitary. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 31.6 kDa (289 aa) |
AA Sequence : | MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN |
Endotoxin : | ≤5 EUs/μg, Kinetic LAL |
Purity : | ≥90%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Fst follistatin [ Mus musculus (house mouse) ] |
Official Symbol | FST |
Synonyms | FST; follistatin; FS; activin-binding protein; AL033346; |
Gene ID | 14313 |
mRNA Refseq | NM_008046 |
Protein Refseq | NP_032072 |
UniProt ID | P47931 |
◆ Recombinant Proteins | ||
FST-27459TH | Recombinant Human FST, His-tagged | +Inquiry |
FST-2333M | Recombinant Mouse FST protein(Met1-Asn317), hFc-tagged | +Inquiry |
FST-6937H | Active Recombinant Human FST protein, His-tagged | +Inquiry |
Fst-560M | Active Recombinant Mouse Follistatin | +Inquiry |
Fst-2759R | Recombinant Rat Fst Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FST-001H | Recombinant Human FST Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FST-1771MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-001MCL | Recombinant Mouse FST cell lysate | +Inquiry |
FST-1833HCL | Recombinant Human FST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FST Products
Required fields are marked with *
My Review for All FST Products
Required fields are marked with *
0
Inquiry Basket