Recombinant Mouse Galc Protein
Cat.No. : | Galc-360M |
Product Overview : | Recombinant Mouse Galc Protein(P54818)(43-684aa) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 43-684aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 73.1kDa |
AA Sequence : | YVLDDSDGLGREFDGIGAVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYELDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWILGAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLDQELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGNMTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREIQELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPPPSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITWAADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFANGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGHGWAAIGTHTFEFAQFDNFRVEAAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Galc galactosylceramidase [ Mus musculus ] |
Official Symbol | Galc |
Synonyms | GALC; galactosylceramidase; galactocerebrosidase; GALCERase; galactocerebroside beta-galactosidase; galactosylceramide beta-galactosidase; twi; Gacy; AW212969; AW413532; twitcher; 2310068B06Rik; A930008M05Rik |
Gene ID | 14420 |
mRNA Refseq | NM_008079 |
Protein Refseq | NP_032105 |
◆ Recombinant Proteins | ||
GALC-4676H | Recombinant Human GALC Protein, GST-tagged | +Inquiry |
Galc-2377M | Recombinant Mouse Galc protein | +Inquiry |
Galc-9308MFL | Recombinant Full Length Mouse Galc, Flag-tagged | +Inquiry |
Galc-188M | Recombinant Mouse Galc | +Inquiry |
GALC-528H | Recombinant Human GALC Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALC-679HCL | Recombinant Human GALC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Galc Products
Required fields are marked with *
My Review for All Galc Products
Required fields are marked with *
0
Inquiry Basket