| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
1-413 aa |
| Description : |
Enables L-aspartate:2-oxoglutarate aminotransferase activity and phosphatidylserine decarboxylase activity. Involved in gluconeogenesis and malate-aspartate shuttle. Acts upstream of or within several processes, including dicarboxylic acid metabolic process; fatty acid homeostasis; and glycerol biosynthetic process. Is active in cytosol. Is expressed in several structures, including alimentary system; central nervous system; genitourinary system; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in amyloidosis; amyotrophic lateral sclerosis; pancreatic ductal adenocarcinoma; and transient cerebral ischemia. Orthologous to human GOT1 (glutamic-oxaloacetic transaminase 1). |
| Form : |
Liquid in. Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol, 1mM DTT |
| Bio-activity : |
Specific activity is > 80 unit/mg, and is defined as the amount of enzyme that converts 1.0 micromole of alpha-ketoglutarate to L-Glutamate per minute at pH 8.0 at 25 centigrade. |
| Molecular Mass : |
48.6 kDa (436aa) confirmed by MALDI-TOF |
| AASequence : |
MAPPSVFAQVPQAPPVLVFKLTADFRDDPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGLAEFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGTDNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLNDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKESDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTMADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ |
| Purity : |
> 95% by SDS-PAGE |
| Applications : |
SDS-PAGE, Enzyme Activity |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| Storage : |
Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.5 mg/mL (determined by Bradford assay) |
