Recombinant Mouse Gpx7 protein, His&Myc-tagged
Cat.No. : | Gpx7-4281M |
Product Overview : | Recombinant Mouse Gpx7 protein(Q99LJ6)(19-186aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-186aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Gpx7 glutathione peroxidase 7 [ Mus musculus ] |
Official Symbol | Gpx7 |
Synonyms | GPX7; glutathione peroxidase 7; GPx-7; GSHPx-7; GPX6; AI327032; 3110050F08Rik; |
Gene ID | 67305 |
mRNA Refseq | NM_024198 |
Protein Refseq | NP_077160 |
◆ Recombinant Proteins | ||
GPX7-2234H | Recombinant Human GPX7 Protein, MYC/DDK-tagged | +Inquiry |
GPX7-2699Z | Recombinant Zebrafish GPX7 | +Inquiry |
GPX7-1391H | Recombinant Human Glutathione Peroxidase 7, His-tagged | +Inquiry |
GPX7-3816H | Recombinant Human GPX7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPX7-5587HF | Recombinant Full Length Human GPX7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPX7-1528HCL | Recombinant Human GPX7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gpx7 Products
Required fields are marked with *
My Review for All Gpx7 Products
Required fields are marked with *