Recombinant Mouse Gpx7 protein, His&Myc-tagged

• Cat.No.: Gpx7-4281M
• Product Overview: Recombinant Mouse Gpx7 protein(Q99LJ6)(19-186aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc
• Protein Length: 19-186aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.7 kDa
• AA Sequence: QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Gpx7 glutathione peroxidase 7 [ Mus musculus ]
• Official Symbol: Gpx7
• Synonyms: GPX7; glutathione peroxidase 7; GPx-7; GSHPx-7; GPX6; AI327032; 3110050F08Rik
• Gene ID: 67305
• mRNA Refseq: NM_024198
• Protein Refseq: NP_077160