Recombinant Mouse Gpx7 protein, His&Myc-tagged

Cat.No. : Gpx7-4281M
Product Overview : Recombinant Mouse Gpx7 protein(Q99LJ6)(19-186aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 19-186aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.7 kDa
AA Sequence : QSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQNYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDTNREIENFARRTYSVSFPMFSKIAVTGTGAHPAFKYLTQTSGKEPTWNFWKYLVDPDGKVVGAWDPTVPVAEIKPRITEQVMKLILRKREDL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Gpx7 glutathione peroxidase 7 [ Mus musculus ]
Official Symbol Gpx7
Synonyms GPX7; glutathione peroxidase 7; GPx-7; GSHPx-7; GPX6; AI327032; 3110050F08Rik;
Gene ID 67305
mRNA Refseq NM_024198
Protein Refseq NP_077160

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gpx7 Products

Required fields are marked with *

My Review for All Gpx7 Products

Required fields are marked with *

0
cart-icon