Recombinant Mouse Gzma protein, His-B2M-tagged

• Cat.No.: Gzma-3009M
• Product Overview: Recombinant Mouse Gzma protein(P11032)(29-260aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: B2M&His
• Protein Length: 29-260aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 39.6 kDa
• AA Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Gzma granzyme A [ Mus musculus ]
• Official Symbol: Gzma
• Synonyms: GZMA; granzyme A; H factor; BLT esterase; fragmentin-1; Hanukah factor; serine esterase 1; t cell-specific serine protease 1; autocrine thymic lymphoma granzyme-like serine protease; Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114
• Gene ID: 14938
• mRNA Refseq: NM_010370
• Protein Refseq: NP_034500