Recombinant Mouse Gzma protein, His-B2M-tagged
Cat.No. : | Gzma-3009M |
Product Overview : | Recombinant Mouse Gzma protein(P11032)(29-260aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 29-260aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Gzma granzyme A [ Mus musculus ] |
Official Symbol | Gzma |
Synonyms | GZMA; granzyme A; H factor; BLT esterase; fragmentin-1; Hanukah factor; serine esterase 1; t cell-specific serine protease 1; autocrine thymic lymphoma granzyme-like serine protease; Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114; |
Gene ID | 14938 |
mRNA Refseq | NM_010370 |
Protein Refseq | NP_034500 |
◆ Recombinant Proteins | ||
GZMA-4024M | Recombinant Mouse GZMA Protein, His (Fc)-Avi-tagged | +Inquiry |
Gzma-4519M | Recombinant Mouse Gzma Protein | +Inquiry |
GZMA-6027C | Recombinant Chicken GZMA | +Inquiry |
GZMA-575H | Recombinant Human GZMA protein, His-tagged | +Inquiry |
GZMA-4516H | Recombinant Human GZMA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gzma Products
Required fields are marked with *
My Review for All Gzma Products
Required fields are marked with *