Recombinant Mouse Gzma protein, His-B2M-tagged
| Cat.No. : | Gzma-3009M |
| Product Overview : | Recombinant Mouse Gzma protein(P11032)(29-260aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | B2M&His |
| Protein Length : | 29-260aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Gzma granzyme A [ Mus musculus ] |
| Official Symbol | Gzma |
| Synonyms | GZMA; granzyme A; H factor; BLT esterase; fragmentin-1; Hanukah factor; serine esterase 1; t cell-specific serine protease 1; autocrine thymic lymphoma granzyme-like serine protease; Hf; SE1; TSP1; Ctla3; TSP-1; Ctla-3; AW494114; |
| Gene ID | 14938 |
| mRNA Refseq | NM_010370 |
| Protein Refseq | NP_034500 |
| ◆ Recombinant Proteins | ||
| GZMA-1036H | Recombinant Human GZMA Protein, His (Fc)-Avi-tagged | +Inquiry |
| GZMA-4517H | Recombinant Human GZMA Protein, GST-tagged | +Inquiry |
| GZMA-252H | Recombinant Human granzyme A Protein, Tag Free | +Inquiry |
| GZMA-427H | ACTIVE Recombinant Human GZMA protein, His-tagged | +Inquiry |
| GZMA-574H | Active Recombinant Human GZMA protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gzma Products
Required fields are marked with *
My Review for All Gzma Products
Required fields are marked with *



