Recombinant Mouse HMGCR Protein (700-860 aa), His-tagged
Cat.No. : | HMGCR-2377M |
Product Overview : | Recombinant Mouse HMGCR Protein (700-860 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 700-860 aa |
Description : | Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.4 kDa |
AA Sequence : | GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Hmgcr 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [ Mus musculus ] |
Official Symbol | HMGCR |
Synonyms | HMGCR; HMG-CoA reductase; 3-hydroxy-3-methylglutaryl-CoA reductase; Red; HMG-CoAR; MGC103269; |
Gene ID | 15357 |
mRNA Refseq | NM_008255 |
Protein Refseq | NP_032281 |
UniProt ID | Q01237 |
◆ Recombinant Proteins | ||
HMGCR-4241M | Recombinant Mouse HMGCR Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCR-19H | Recombinant Human HMGCR protein, GST-tagged | +Inquiry |
HMGCR-669H | Recombinant Human HMGCR Protein (Ser426-Ala888), His-tagged | +Inquiry |
HMGCR-2523R | Recombinant Rat HMGCR Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCR-263H | Active Recombinant Human HMGCR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGCR-802HCL | Recombinant Human HMGCR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGCR Products
Required fields are marked with *
My Review for All HMGCR Products
Required fields are marked with *
0
Inquiry Basket