Recombinant Mouse HMGCR Protein (700-860 aa), His-tagged

Cat.No. : HMGCR-2377M
Product Overview : Recombinant Mouse HMGCR Protein (700-860 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 700-860 aa
Description : Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.4 kDa
AA Sequence : GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGH
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Hmgcr 3-hydroxy-3-methylglutaryl-Coenzyme A reductase [ Mus musculus ]
Official Symbol HMGCR
Synonyms HMGCR; HMG-CoA reductase; 3-hydroxy-3-methylglutaryl-CoA reductase; Red; HMG-CoAR; MGC103269;
Gene ID 15357
mRNA Refseq NM_008255
Protein Refseq NP_032281
UniProt ID Q01237

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMGCR Products

Required fields are marked with *

My Review for All HMGCR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon