Active Recombinant Mouse Il13 Protein

Cat.No. : Il13-087M
Product Overview : Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
Bio-activity : The ED50 as determined by the dose-dependent proliferation of TF-1 cells was > 4.0 ng/ml, corresponding to a specific activity of > 2.5 x 10^5 units/mg.
Molecular Mass : 12.3 kDa
AA Sequence : MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Publications :
IFN-γ Limits Immunopathogenesis but Delays Fungal Clearance during Pneumocystis Pneumonia (2023)
Gene Name Il13 interleukin 13 [ Mus musculus (house mouse) ]
Official Symbol Il13
Synonyms Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600
Gene ID 16163
mRNA Refseq NM_008355
Protein Refseq NP_032381
UniProt ID P20109

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il13 Products

Required fields are marked with *

My Review for All Il13 Products

Required fields are marked with *

0
cart-icon
0
compare icon