Active Recombinant Mouse Il13 Protein

• Cat.No.: Il13-087M
• Product Overview: Purified recombinant protein of Mouse interleukin 13 (Il13) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses. Positively regulates IL31RA expression in macrophages.
• Bio-activity: The ED50 as determined by the dose-dependent proliferation of TF-1 cells was > 4.0 ng/ml, corresponding to a specific activity of > 2.5 x 10^5 units/mg.
• Molecular Mass: 12.3 kDa
• AA Sequence: MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.
• Publications:
  IFN-γ Limits Immunopathogenesis but Delays Fungal Clearance during Pneumocystis Pneumonia (2023)

Gene Information

• Gene Name: Il13 interleukin 13 [ Mus musculus (house mouse) ]
• Official Symbol: Il13
• Synonyms: Il13; interleukin 13; Il-13; interleukin-13; T-cell activation protein P600
• Gene ID: 16163
• mRNA Refseq: NM_008355
• Protein Refseq: NP_032381
• UniProt ID: P20109