Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
146 |
Description : |
IL-22 is belonging to IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes and dendritic cells, IL-10 contributes to the inflammatory response in vivo. IL-22 signals through CRF2-4 and IL-22. It along with IL-17 is rapidly produced by splenic LTi-like cells and can be also produced by Th17 cells. IL-22 likely plays a role in the coordinated response of both adaptive and innate immune systems. Recombinant mouse interleukin-22 contains 147 amino acids and it has approximately 81 % and 92 % amino acid sequence identity with human and rat IL-22. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 1 × PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.2 ng/ml, corresponding to a specific activity of > 5.0 × 10⁶ IU/mg. |
Molecular Mass : |
Approximately 16.6 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids. |
AA Sequence : |
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV |
Endotoxin : |
Less than 1 EU/μg of rMuIL-22 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |