Active Recombinant Mouse Il28a Protein

Cat.No. : Il28a-5202M
Product Overview : Mouse Il28a (Q4VK74) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Interleukin-28 (IL-28) is a cytokine that comes in two isoforms, IL-28A and IL-28B, and plays a role in immune defense against viruses, including the induction of an "antiviral state" by turning on Mx proteins, 2',5'-oligoadenylate synthetase as well as ISGF3G (Interferon Stimulated Gene Factor 3). IL-28A and IL-28B belong to the type III interferon family of cytokines and are highly similar (in amino acid sequence) to IL-29. Their classification as Interferons is due to their ability to induce an antiviral state, while their additional classification as cytokines is due to their chromosomal location as well as the fact that they are encoded by multiple exons, as opposed to a single exon, as most type-I IFNs are.
Form : Lyophilized
Bio-activity : Determined by its ability to activate STAT following receptor-ligand interaction.
Molecular Mass : 25.0 kDa
AA Sequence : MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV
Endotoxin : Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
Purity : 98%
Applications : Functional Study
SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name Il28a interleukin 28A [ Mus musculus ]
Official Symbol Il28a
Synonyms IL28A; interleukin 28A; interleukin-28A; IFN-lambda2; IFN-lambda-2; interferon-lambda2; interferon lambda-2; Ifnl2; IL-28A; EG330496;
Gene ID 330496
mRNA Refseq NM_001024673
Protein Refseq NP_001019844

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il28a Products

Required fields are marked with *

My Review for All Il28a Products

Required fields are marked with *

0
cart-icon