Active Recombinant Mouse Il28a Protein
| Cat.No. : | Il28a-5202M |
| Product Overview : | Mouse Il28a (Q4VK74) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Description : | Interleukin-28 (IL-28) is a cytokine that comes in two isoforms, IL-28A and IL-28B, and plays a role in immune defense against viruses, including the induction of an "antiviral state" by turning on Mx proteins, 2',5'-oligoadenylate synthetase as well as ISGF3G (Interferon Stimulated Gene Factor 3). IL-28A and IL-28B belong to the type III interferon family of cytokines and are highly similar (in amino acid sequence) to IL-29. Their classification as Interferons is due to their ability to induce an antiviral state, while their additional classification as cytokines is due to their chromosomal location as well as the fact that they are encoded by multiple exons, as opposed to a single exon, as most type-I IFNs are. |
| Form : | Lyophilized |
| Bio-activity : | Determined by its ability to activate STAT following receptor-ligand interaction. |
| Molecular Mass : | 25.0 kDa |
| AA Sequence : | MDPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFRLLTRDLKCVASGDQCV |
| Endotoxin : | Endotoxin level is < 0.1 ng/μg (< 1 EU/μg). |
| Purity : | 98% |
| Applications : | Functional Study SDS-PAGE |
| Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
| Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
| Gene Name | Il28a interleukin 28A [ Mus musculus ] |
| Official Symbol | Il28a |
| Synonyms | IL28A; interleukin 28A; interleukin-28A; IFN-lambda2; IFN-lambda-2; interferon-lambda2; interferon lambda-2; Ifnl2; IL-28A; EG330496; |
| Gene ID | 330496 |
| mRNA Refseq | NM_001024673 |
| Protein Refseq | NP_001019844 |
| ◆ Recombinant Proteins | ||
| IL28A-136H | Active Recombinant Human IL28A protein | +Inquiry |
| IL28A-131H | Recombinant Human Interleukin 28A (interferon, lambda 2) | +Inquiry |
| IL28A-312H | Active Recombinant Human IL28A, HIgG1 Fc-tagged | +Inquiry |
| IL28A-313H | Recombinant Human IL28A, Fc-tagged | +Inquiry |
| IL28A-311H | Active Recombinant Human IL28A, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL28A-5229HCL | Recombinant Human IL28A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il28a Products
Required fields are marked with *
My Review for All Il28a Products
Required fields are marked with *
