Recombinant Mouse IL2RB Protein, His-tagged
Cat.No. : | IL2RB-1257M |
Product Overview : | Recombinant Mouse IL2RB Protein (27-240aa) was expressed in Yeast with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-240 a.a. |
Description : | The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 27.0 kDa |
AA Sequence : | AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPES QSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYL EFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPAD PMKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Il2rb interleukin 2 receptor, beta chain [ Mus musculus (house mouse) ] |
Official Symbol | IL2RB |
Synonyms | p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta |
Gene ID | 16185 |
mRNA Refseq | NM_008368.4 |
Protein Refseq | NP_032394.1 |
UniProt ID | P16297 |
◆ Recombinant Proteins | ||
RFL8063HF | Recombinant Full Length Human Interleukin-2 Receptor Subunit Beta(Il2Rb) Protein, His-Tagged | +Inquiry |
IL2RB-247H | Recombinant Human IL2RB Protein (Ala27-Asp239), C-6×His-tagged | +Inquiry |
Il2rb-484M | Recombinant Mouse Il2rb(Ala27-Glu240) Protein, C-Fc-tagged | +Inquiry |
Il2rb-3101M | Recombinant Mouse Il2rb protein, His-tagged | +Inquiry |
IL2RB-2248R | Recombinant Rhesus monkey IL2RB Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RB-2906HCL | Recombinant Human IL2RB cell lysate | +Inquiry |
IL2RB-744MCL | Recombinant Mouse IL2RB cell lysate | +Inquiry |
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2RB Products
Required fields are marked with *
My Review for All IL2RB Products
Required fields are marked with *