Cat.No.:	IL2RB-1257M
Product Overview:	Recombinant Mouse IL2RB Protein (27-240aa) was expressed in Yeast with N-terminal His-tag.
Description:	The interleukin 2 receptor is composed of alpha and beta subunits. The beta subunit encoded by this gene is very homologous to the human beta subunit and also shows structural similarity to other cytokine receptors.
Source:	Yeast
Species:	Mouse
Tag :	His
Form:	Tris-based buffer, 50% glycerol.
Molecular Mass:	27.0 kDa
AA Sequence:	AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPES QSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYL EFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPAD PMKE
Purity:	Greater than 90% as determined by SDS-PAGE.
Storage:	The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Name:	Il2rb interleukin 2 receptor, beta chain [ Mus musculus (house mouse) ]
Official Symbol:	IL2RB
Synonyms:	p70; CD122; IL15Rbeta; Il-2Rbeta; IL-15Rbeta; Il-2/15Rbeta
Gene ID:	16185
mRNA Refseq:	NM_008368.4
Protein Refseq:	NP_032394.1
UniProt ID:	P16297

Online Inquiry