Recombinant Mouse Interleukin 12 Protein, His tagged

Cat.No. : IL12-21M
Product Overview : Recombinant mouse IL12b/IL12a protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Baculovirus
Tag : His
Protein Length : 23-335aa(p40)/23-215aa(p35)
Description : IL12b/IL12a, also known as interleukin 12 (subunit beta/alpha), is a cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. It is a key mediator of cellular-immunity and induces the differentiation of Th1 cells from precursor T helper cells. As it is associated with IL23A to form the IL-23 interleukin, it induces autoimmune inflammation and is responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Tag : C-His
Form : Liquid
Bio-activity : The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 for this effect is less or equal to 10 ng/mL.
Molecular Mass : 58.3 kDa
AA Sequence : IL12B (p40): MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
IL12A (p35): RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
GeneID 2 : 16159
References : 1. Zhang X., et al, (2015) J Immunol. 195:1665-1675.
2. Zamani A., et al, (2017) Immune Netw. 17:186-191.
Gene Name Il12b interleukin 12b [ Mus musculus (house mouse) ]
Official Symbol IL12B
Synonyms IL12B; interleukin 12b; interleukin-12 subunit beta; CLMF p40; IL-12 p40; IL-12 subunit p40; IL-23 subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; p40; Il-12b; Il12p40; Il-12p40;
Gene ID 16160
mRNA Refseq NM_001303244
Protein Refseq NP_001290173
UniProt ID P43432
Gene Name 2 Il12a interleukin 12a [ Mus musculus (house mouse) ]
Official Symbol 2 IL12A
Synonyms 2 IL12A; interleukin 12a; interleukin-12 subunit alpha; CLMF p35; IL-12 subunit p35; interleukin 12a p35 subunit; cytotoxic lymphocyte maturation factor 35 kDa subunit; p35; Ll12a; Il-12a; IL-12p35; MGC151228; MGC151232;
mRNA Refseq 2 NM_008351
Protein Refseq 2 NP_032377
UniProt ID 2 P43431

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12 Products

Required fields are marked with *

My Review for All IL12 Products

Required fields are marked with *

0
cart-icon
0
compare icon