Recombinant Mouse Interleukin 12 Protein, His tagged
| Cat.No. : | IL12-21M |
| Product Overview : | Recombinant mouse IL12b/IL12a protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Baculovirus |
| Tag : | His |
| Protein Length : | 23-335aa(p40)/23-215aa(p35) |
| Description : | IL12b/IL12a, also known as interleukin 12 (subunit beta/alpha), is a cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. It is a key mediator of cellular-immunity and induces the differentiation of Th1 cells from precursor T helper cells. As it is associated with IL23A to form the IL-23 interleukin, it induces autoimmune inflammation and is responsible for autoimmune inflammatory diseases and may be important for tumorigenesis. |
| Tag : | C-His |
| Form : | Liquid |
| Bio-activity : | The activity is determined by the IFN-g ELISA in a using NK-92 human natural killer cells. The ED50 for this effect is less or equal to 10 ng/mL. |
| Molecular Mass : | 58.3 kDa |
| AA Sequence : | IL12B (p40): MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS IL12A (p35): RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA |
| Endotoxin : | < 1 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.5 mg/mL (determined by Bradford assay) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
| GeneID 2 : | 16159 |
| References : | 1. Zhang X., et al, (2015) J Immunol. 195:1665-1675. 2. Zamani A., et al, (2017) Immune Netw. 17:186-191. |
| Gene Name | Il12b interleukin 12b [ Mus musculus (house mouse) ] |
| Official Symbol | IL12B |
| Synonyms | IL12B; interleukin 12b; interleukin-12 subunit beta; CLMF p40; IL-12 p40; IL-12 subunit p40; IL-23 subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; p40; Il-12b; Il12p40; Il-12p40; |
| Gene ID | 16160 |
| mRNA Refseq | NM_001303244 |
| Protein Refseq | NP_001290173 |
| UniProt ID | P43432 |
| Gene Name 2 | Il12a interleukin 12a [ Mus musculus (house mouse) ] |
| Official Symbol 2 | IL12A |
| Synonyms 2 | IL12A; interleukin 12a; interleukin-12 subunit alpha; CLMF p35; IL-12 subunit p35; interleukin 12a p35 subunit; cytotoxic lymphocyte maturation factor 35 kDa subunit; p35; Ll12a; Il-12a; IL-12p35; MGC151228; MGC151232; |
| mRNA Refseq 2 | NM_008351 |
| Protein Refseq 2 | NP_032377 |
| UniProt ID 2 | P43431 |
| ◆ Recombinant Proteins | ||
| IL12-433H | Recombinant Human IL12 Protein, His-Avi-tagged | +Inquiry |
| Il12a-086M | Recombinant Mouse Il12 Protein, Fc tagged | +Inquiry |
| IL12-159HB | Recombinant Human IL12 protein, His-tagged, Biotinylated | +Inquiry |
| IL23A&IL12B-01HFL | Recombinant Human IL23 Protein, His tagged | +Inquiry |
| IL12B&IL12A-004H | Active Recombinant Human IL12B&IL12A, HIgG1 Fc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12 Products
Required fields are marked with *
My Review for All IL12 Products
Required fields are marked with *
