Active Recombinant Mouse Il12a Protein

Cat.No. : Il12a-086M
Product Overview : Purified recombinant protein of Mouse interleukin 12a (Il12a), transcript variant 2 without tag was expressed in CHO cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : CHO
Description : Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Bio-activity : Assay #1: ED50 was determined by the stimulation of IFN-gamma production by murine splenocytes co-stimulated with IL-18 is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: Determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is <0.1ng/ml, corresponding to a specific activity of >1 x 10^7 units/mg.
Molecular Mass : 75 kDa
AA Sequence : p35 Subunit: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
p40 Subunit: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Il12a interleukin 12a [ Mus musculus (house mouse) ]
Official Symbol Il12a
Synonyms Il12a; interleukin 12a; p35; Ll12a; Il-12a; IL-12p35; interleukin-12 subunit alpha; CLMF p35; IL-12 p35 subunit; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12a p35 subunit; interleukin-12 p35 subunit
Gene ID 16159
mRNA Refseq NM_008351
Protein Refseq NP_032377
UniProt ID P43431

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il12a Products

Required fields are marked with *

My Review for All Il12a Products

Required fields are marked with *

0

Inquiry Basket

cartIcon