Active Recombinant Mouse Il12a Protein

• Cat.No.: Il12a-086M
• Product Overview: Purified recombinant protein of Mouse interleukin 12a (Il12a), transcript variant 2 without tag was expressed in CHO cell.

Specification

• Species: Mouse
• Source: CHO
• Description: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
• Bio-activity: Assay #1: ED50 was determined by the stimulation of IFN-gamma production by murine splenocytes co-stimulated with IL-18 is > 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. Assay #2: Determined by its ability to stimulate the proliferation of 2D6 cells. The expected ED50 is <0.1ng/ml, corresponding to a specific activity of >1 x 10^7 units/mg.
• Molecular Mass: 75 kDa
• AA Sequence: p35 Subunit: RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA
  p40 Subunit: MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Il12a interleukin 12a [ Mus musculus (house mouse) ]
• Official Symbol: Il12a
• Synonyms: Il12a; interleukin 12a; p35; Ll12a; Il-12a; IL-12p35; interleukin-12 subunit alpha; CLMF p35; IL-12 p35 subunit; IL-12 subunit p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; interleukin 12a p35 subunit; interleukin-12 p35 subunit
• Gene ID: 16159
• mRNA Refseq: NM_008351
• Protein Refseq: NP_032377
• UniProt ID: P43431