Recombinant Mouse LGALS4 Protein (1-326 aa), His-tagged

Cat.No. : LGALS4-2053M
Product Overview : Recombinant Mouse LGALS4 Protein (1-326 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-326 aa
Description : Galectin that binds lactose and a related range of sugars.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 38.4 kDa
AA Sequence : MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus ]
Official Symbol LGALS4
Synonyms LGALS4; galectin-4; lactose-binding lectin 4; gal-4;
Gene ID 16855
mRNA Refseq NM_010706
Protein Refseq NP_034836
UniProt ID Q8K419

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS4 Products

Required fields are marked with *

My Review for All LGALS4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon