Recombinant Mouse LGALS4 Protein (1-326 aa), His-tagged
Cat.No. : | LGALS4-2053M |
Product Overview : | Recombinant Mouse LGALS4 Protein (1-326 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-326 aa |
Description : | Galectin that binds lactose and a related range of sugars. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus ] |
Official Symbol | LGALS4 |
Synonyms | LGALS4; galectin-4; lactose-binding lectin 4; gal-4; |
Gene ID | 16855 |
mRNA Refseq | NM_010706 |
Protein Refseq | NP_034836 |
UniProt ID | Q8K419 |
◆ Recombinant Proteins | ||
Lgals4-5678M | Active Recombinant Mouse Lectin, Galactose Binding, Soluble 4 | +Inquiry |
LGALS4-323H | Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
LGALS4-412C | Recombinant Cattle LGALS4 Protein, His-tagged | +Inquiry |
LGALS4-5069H | Recombinant Human Lectin, Galactoside-Binding, Soluble, 4, His-tagged | +Inquiry |
LGALS4-4439H | Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS4 Products
Required fields are marked with *
My Review for All LGALS4 Products
Required fields are marked with *