Recombinant Mouse LGALS4 Protein (1-326 aa), His-tagged
| Cat.No. : | LGALS4-2053M |
| Product Overview : | Recombinant Mouse LGALS4 Protein (1-326 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-326 aa |
| Description : | Galectin that binds lactose and a related range of sugars. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 38.4 kDa |
| AA Sequence : | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus ] |
| Official Symbol | LGALS4 |
| Synonyms | LGALS4; galectin-4; lactose-binding lectin 4; gal-4; |
| Gene ID | 16855 |
| mRNA Refseq | NM_010706 |
| Protein Refseq | NP_034836 |
| UniProt ID | Q8K419 |
| ◆ Recombinant Proteins | ||
| LGALS4-3389R | Recombinant Rat LGALS4 Protein | +Inquiry |
| Lgals4-7261M | Active Recombinant Mouse Lgals4 Protein, His-tagged | +Inquiry |
| LGALS4-192H | Active Recombinant Human LGALS4 Protein (Ala2-Ile323), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| LGALS4-2053M | Recombinant Mouse LGALS4 Protein (1-326 aa), His-tagged | +Inquiry |
| LGALS4-10H | Active Recombinant Human LGALS4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS4 Products
Required fields are marked with *
My Review for All LGALS4 Products
Required fields are marked with *
