Recombinant Mouse Mog protein, His-tagged
| Cat.No. : | Mog-3101M |
| Product Overview : | Recombinant Mouse Mog protein(Q61885)(29-156aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-156aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT |
| Gene Name | Mog myelin oligodendrocyte glycoprotein [ Mus musculus ] |
| Official Symbol | Mog |
| Synonyms | MOG; myelin oligodendrocyte glycoprotein; myelin-oligodendrocyte glycoprotein; B230317G11Rik; |
| Gene ID | 17441 |
| mRNA Refseq | NM_010814 |
| Protein Refseq | NP_034944 |
| ◆ Recombinant Proteins | ||
| Mog-4111M | Recombinant Mouse Mog Protein, Myc/DDK-tagged | +Inquiry |
| MOG-5453H | Recombinant Human MOG Protein, MYC/DDK-tagged | +Inquiry |
| MOG-043R | Recombinant Rat myelin oligodendrocyte glycoprotein Protein, His tagged | +Inquiry |
| MOG-3828H | Recombinant Human MOG protein(Gly30-Tyr149), His-tagged | +Inquiry |
| MOG-060H | Active Recombinant Human MOG Protein | +Inquiry |
| ◆ Native Proteins | ||
| MOG-20 | Native Mouse/Rat MOG (35-55) Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MOG-1126HCL | Recombinant Human MOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mog Products
Required fields are marked with *
My Review for All Mog Products
Required fields are marked with *
